jijji

yes of course they all denied ever being sick in November 2019. China even denied that the wet market was the original source of infection. China also disputed any claims that they practiced "gain of function" research at all at WIV, even though that was uncovered by the recent evidence presented in Congress against Anthony Fauci, who funded the whole thing in the first place.

Well, according to some reports, the first reported incidents happened in November 2019 and the months prior, from people who worked at Wuhan Institute of Virology (according to US government sources) [0]. Those people were: Ben Hu, Yu Ping, Zhu Yan.

[0] https://www.public.news/p/first-people-sickened-by-covid-19

when you watch the video he has some really cool design ideas about buildings, like the one with the aquarium in the middle all the way up the structure provides natural lighting and no one has ever attempted to build such cool features into a building.... very impressive

they have yet to publish any of the system prompts that they used for their agents.... do you think an LLM agent would act on its own to try to do that kind of behavior (finding/writing exploits for acccess to remote servers) without being prompted? If so, why dont they release the transcripts of their prompts with their "rogue" agent(s) and try to clear the air. They havent done that.

in orchestration, the agents are only fed the tasks given by the person running the orchestration side and if we are talking about code changes and git commits and deployments, this is pretty benign behavior. "Hacking external servers" I am pretty sure would have to be written in the prompts to begin with to allow this to occur in the first place.

The start date was December 10, 2004 when google rolled out a feature called "Google Suggest", which when a person types in "men can" it displays a drop down list with ridiculous responses such as "men can get pregnant" and "men can have periods". If I had to pick a date, that was the beginning of the end for me.

what would be more interesting for me to see is what prompts were given to the agents, which so far have not been described. The whole situation sounds manufactured. I highly doubt that a whole bunch of agents were acting this way without being prompted to, it just doesn't add up. if anything it seems like an organized fraud or something created by a human. I'm surprised there's not a criminal investigation against openai right now where the FBI or whoever is not looking over exactly what happened and who did it because I'll tell you somebody did it somebody wrote those prompts... it didn't just happen by itself...

looks like a protection racket for the frontier models, with the goal being to eventually outlaw non-US frontier models.

AI LLM systems, i.e. perplexity.ai, are very good at tutoring someone about how something works, i.e. advanced math, and when done in a loop can be very useful at tutoring, better than youtube videos I've seen on the same subject. The one thing I will usually request in (in the case of math), is to suffix the prompt with "explain this in terms a 9th grader would understand", and this is good enough to explain something in simpler terms with various breakdowns that can be understood by anyone to tutor yourself in alot of subjects using this method. This can be applied to programming, auto repair, construction, almost any subject at this point.

> Error handling is largely commented out.

I guess we won't really know when the file system breaks or corrupts data

so this story is something that's really important for everybody to know about and should not get downvoted...

another story about the lack of chain-of-thought reasoning traces in frontier models...

The oxymoron of OpenAI in its name and its actions should give the collaborator all he/she needs to know.

The lack of reasoning traces in frontier model output is hurting science and progress... thats my take away from reading that, and why open source models are so critical and so needed, because they actually do expose the chain-of-thought reasoning traces recently missing from the frontier models (openAI, anthropic, etc). By encrypting and purposely hiding this important information from public inspection, it makes for a world where people lack the true understanding of how a problem gets solved.

i thought everyone got rid of vmware in 2007 when virtualbox came out... wow cant believe people still pay for that

you could backdoor not only the strip command but alot of other commands that work on elf binaries: strings, strace, objdump, nm, ldd, etc

I think as long as you dont copy the exact 39 amino acid structure of Retatrutide, and dont use the word "Retatrutide" to describe it, you'll be outside the lawsuit targets of Eli Lilly. You'd want to improve the structure in some way, possibly by reducing the GI effects, as an example:

retatrutide sequence: YAQGTFTSDYSILLDKKAQAAFIEYLLEGGPSSGAPPPS

modified sequence to reduce GI symptoms: YAQGTFTSDYSILLDKKAHAAFIEYLLEGGPSSGAPPPS

The difference is in spot 18, where it swaps the alanine with a histidine, which may reduce GI effects/nausea.

reference: https://doi.org/10.7554/elife.68719

Another improvement might be to add amylin/calcitonin receptor agonist to the sequence (similar to cagrilintide). (reference: https://www.nejm.org/doi/full/10.1056/NEJMoa2502081)

wow if the paint.net people are trying to win an award for most popup advertising on one web page, they have my vote!

try to get the doorbell to send the webhook locally to Home Assistant, bypassing steps 2, 3 and 4

I for one welcome our new robot overlords.

The release date is supposed to be August 28th 2026

The article says that once converted to BMP all the metadata gets removed....so on linux:

convert file.jpg file.bmp; convert file.bmp file.jpg

peptides seemed to have popped up about 10 years ago.... now we've got probably over 100 common peptides that are used for various things, here is a sample:

1) PT-141 is a peptide that releases sex hormone into the blood and literally makes you horny, and its primary use is for premenopausal women that have low sex drive.

2) PNC-27 is a peptide that supposedly attaches to the cell membrane of tumor cells and performs cell lysis (death) of the tumor cell, and it's supposedly affects many different kinds of tumor cells: breast, pancreatic, lung, colon, ovarian, cervical, and leukemia

3) Epithalon is a peptide that is noted for extending telomers on chromosomes, leading to longevity benefits.

4) MOTS-c is it peptide that in animal studies is shown to boost physical endurance and mimic molecular changes associated with training/exercise.

The problem with certain peptides (the Eli Lilly patented ones like Tirzepatide and Retatrutide) is that when you carefully look at whats going on, you'll notice that they are recently filing lawsuits for anyone who mentions those words on their website, even med spa's and compounding pharmacies [0].

It is legal to sell research only peptides that are not FDA approved, but as soon you talk about efficacy and human use, you also become a target for the FDA warning letters. [1] [2] [3].

Anyone selling these peptides who are indexed by search engines face increase scrutiny immediately, especially if you're going to try to sell the patented ones, because then you're a Target of not just the FDA but also Eli Lilly... peptides are big business but it's big risk if you do it wrong.... Eli Lily wants people spending $1,000 per month to use these peptides.

I think the trick about selling peptides to people is to probably do it word of mouth, no indexing by google, no ads, double gated website with invite only structure.

[0] https://www.npr.org/2026/08/13/g-s1-138594/eli-lilly-files-6...

[1] https://www.fda.gov/inspections-compliance-enforcement-and-c...

[2] https://www.fda.gov/inspections-compliance-enforcement-and-c...

[3] https://www.raps.org/resource/fda-warning-letters-target-mar...

amatuer... when you leave the us you bring a wiped phone, never bring your primary phone/laptop/camera/etc

so basically anybody who uses openrouter from now on is going to have all their data exfiltrated to stripe and then to all the banks/insurance companies... when I read the article that's what I think is going on and it doesn't smell good....

this isnt about the progress of FHE, this is about models hiding reasoning traces (i.e. "thinking") from their paying customers because they dont want them knowing how question A got to answer B.

gaslighting people by pretending that encrypting reasoning traces between agent and client is a win for "private AI"... the title should be rewritten as it is plainly conceding -- Closed AI providers use encrypted reasoning traces to hide what the model is doing to come to a conclusion. This is not scientific progress, this is molopoly protectionism. No person using these models wants the reasoning traces hidden from them, it prevents the user from learning how conclusions about a question are derived.

The fact that frontier LLM providers pirated all the data that they used for training, then to go on to encrypt all of the reasoning traces that they use to come up with the conclusions it's really disingenuous, and then have the balls to say distillation is some kind of bad behavior. they are the kings of distillation.

The hiding of this data only brings distrust to their frontier models. I think most people want to understand how something comes to a conclusion they don't want have that part left out on purpose...

it's this kind of behavior that forces people move to to open source models in the end, it's the lack of trust. the frontier model providers treat the end user/customer as a threat or adversary. Fable 5 is notorious for this. a lot of the serious questions you ask the model they won't even respond to you because of the woke guardrails. it wasn't only a couple weeks ago that huggingface had to use glm 5.2 to get the right answers about their security incident because Fable 5 didn't want to answer it.

rust programs are a lot of times faster and orders of magnitude safer than C and C++ counterparts... where is your data to support your assertion that rust programs use more resources than C and C++ programs?